Protein Info for Psest_2846 in Pseudomonas stutzeri RCH2

Annotation: monovalent cation/proton antiporter, MnhG/PhaG subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 11 to 99 (89 residues), 106.2 bits, see alignment E=4.2e-35 PF03334: PhaG_MnhG_YufB" amino acids 12 to 93 (82 residues), 106.3 bits, see alignment E=4e-35

Best Hits

Swiss-Prot: 39% identical to MRPG_BACPE: Na(+)/H(+) antiporter subunit G (mrpG) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K05564, multicomponent K+:H+ antiporter subunit G (inferred from 94% identity to psa:PST_1534)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPP3 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Psest_2846 monovalent cation/proton antiporter, MnhG/PhaG subunit (Pseudomonas stutzeri RCH2)
MPFWIEVLVSVFLIIGSLFALVGAIGLYRLPDFYTRLHGPTKATTLGVGGVVIASMIFFS
NQNGSLSLHELLITLFLFLTAPVSAHILAKAAMQQKLPAVEQTRGKPWD