Protein Info for PGA1_c28330 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 109 to 278 (170 residues), 83.3 bits, see alignment E=9.5e-28

Best Hits

Swiss-Prot: 36% identical to TAUC_ECOLI: Taurine transport system permease protein TauC (tauC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 83% identity to sit:TM1040_3034)

MetaCyc: 36% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"ABC transporter permease protein with unknown substrate"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3Y7 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PGA1_c28330 ABC transporter permease protein (Phaeobacter inhibens DSM 17395)
MSDTRMATLPPVPNTETPHQHAPVRPVQFRGGGFAPRGARWVGALVFVLLLVLAELGTRQ
GWISNLTLPRPSDVLATLGELYASGLLWTHVSVSLSRLVVGAALGASVGVGVGVMIGLFS
YVRAGLVPLVAALFPIPKIALLPLFVIWFGIDEASKYALIAFGTFTPTVVATYGAVDNVD
RTLIRMGQSFNLSWLSIVRKIVLPGAMPGILSGLRISLAIAIILLVAAEMLGAEHGIGAY
ILEAGSLYDLERLFAGVAILSVLGVLVSSLIGQVERRLLRWRG