Protein Info for PGA1_c28320 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00005: ABC_tran" amino acids 18 to 157 (140 residues), 109.2 bits, see alignment E=3.8e-35

Best Hits

Swiss-Prot: 41% identical to TAUB3_PARXL: Taurine import ATP-binding protein TauB 3 (tauB3) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 81% identity to sit:TM1040_3035)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, ATPase component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQC0 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PGA1_c28320 ABC transporter, ATP-binding protein (Phaeobacter inhibens DSM 17395)
MDIRLSAVGHAYDNVAVLSDITLDIPSGKIVCIVGPSGCGKSTLLRFIGGLERPTQGEVL
QVGQPPEGCLNPLTYVFQDFALLPWRTVRGNISLVLEDHGIRGAAAARIIDDVLARTKLS
DFAGALPKQLSGGMKQRVAIARALAVNPAVMLMDEPLSALDSQTRELLMDDLVALWTRTP
FTAVYVTHNLAEAVRLGHAIVVLSRRPGQIREIVHLDTPLAERAFGDADLEQKQKYLWQL
MRDEARAADAELMNV