Protein Info for Psest_2844 in Pseudomonas stutzeri RCH2

Annotation: methionine aminopeptidase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00500: methionine aminopeptidase, type I
  • amino acids 4 to 249 (246 residues), 348.5 bits, E=1.1e-108
• PF00557: Peptidase_M24
  • amino acids 12 to 241 (230 residues), 199.3 bits, E=3.3e-63

Best Hits

Swiss-Prot: 68% identical to MAP1_SHIFL: Methionine aminopeptidase (map) from Shigella flexneri

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 98% identity to psa:PST_1536)

MetaCyc: 68% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

• Arg/N-end rule pathway (eukaryotic) (8/14 steps found)
• Ac/N-end rule pathway (6/21 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

See L0GKR1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Psest_2844 methionine aminopeptidase, type I (Pseudomonas stutzeri RCH2)
MTVTIKTPEDIEKMRIAGRLAAEVLEMIGEHVKPGVTTEELDRLCHEHIVNVQQAIPAPL
NYKGFPKSICTSINHVVCHGIPNDKPLKDGDILNIDITVIKDGYHGDTSKMFMVGKVPEW
AERLCQVTQECLYKGIELVRPGARLGDIGEVIQKHAEKNGFSVVREYCGHGIGKVFHEEP
QVLHYGRAGTGMELKEGMTFTIEPMINQGRSETRLLGDGWTAITKDRKLSAQWEHTILVT
ADGYEIFTLRSDDTIARTSA