Protein Info for PGA1_c28140 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 65 to 342 (278 residues), 144.7 bits, see alignment E=1.5e-46

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 89% identity to sit:TM1040_0495)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F297 at UniProt or InterPro

Protein Sequence (360 amino acids)

>PGA1_c28140 ABC transporter, permease protein (Phaeobacter inhibens DSM 17395)
MIRLEKRPQPSRVWSMATPLVAVLATMIAGGLLFAALGKDPVAAIRTIFWDPLFGEFAFY
YRPQLLVKGAPLVLIAIGLSLGFRAGIWNIGAEGQYIMGAICGAGAGLAFYPSDSVLIFP
LMVVAGALGGWAWAMIPAVLKTRFGTNEILVSLMLVYVAEQFLASVSLGLLKNPEGFGFP
GSRNLQSWDSAHNAELIMGTGMHWGVVAALIAVIFAYVLLNRHMLGYHIRLTGEAPRAAR
FAGVNPTRLVLFCLGTSGALAGLAGLFEVSGPSGQISIDFNVGYGFTAIIVAFLGRLHPV
GILLAGELMALTYIGGDIAQSNMGLPSAAIQVFQGMLLFFLLAFDLLTNFRLTLRKREVA