Protein Info for PGA1_c28100 in Phaeobacter inhibens DSM 17395

Annotation: xanthine dehydrogenase XdhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 3 to 466 (464 residues), 605.6 bits, E=2.9e-186
• PF00111: Fer2
  • amino acids 6 to 57 (52 residues), 34.6 bits, 3.1e-12
• PF01799: Fer2_2
  • amino acids 78 to 147 (70 residues), 91.5 bits, E=5.7e-30
• PF00941: FAD_binding_5
  • amino acids 194 to 357 (164 residues), 167.4 bits, E=5.2e-53
• PF03450: CO_deh_flav_C
  • amino acids 368 to 467 (100 residues), 110.7 bits, E=7.3e-36

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 74% identity to sit:TM1040_0499)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (10/11 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• ureide biosynthesis (6/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (12/18 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

See I7DTR4 at UniProt or InterPro

Protein Sequence (481 amino acids)

>PGA1_c28100 xanthine dehydrogenase XdhA (Phaeobacter inhibens DSM 17395)
MTITFRLNGEEVALTEVSPTATLLDWLREDRGLTGTKEGCNEGDCGACTVMVTDGHGAKP
LNACILFLPQLHGKSIRTVEGAAGPDGQLHPVQEAMITHHGSQCGFCTPGFIMSMVTAHK
NGAQDHDDQLAGNLCRCTGYAPIIRAAEAAAEAPVPDWIRAENSVTFPEILRGEAAGRGA
EPPNQNSAEPPASLRPTSADQLAAAYAARPDATLIAGATDVGLWVTKQLRDLSDVIFLDG
CEDLKEITQQPDGSLRIGAMVDMNRLRSALAARHPSYGEMLRRFASQQVRAAATIGGNIA
NGSPIGDNPPALIALGAMLHLRHGDSRRSLPLEEFFLDYGKQDRQPGEFVEAITLPALPA
EQADALRVYKLSKRFDQDISAVLGAFNLTVDDGRITAARIAFGGMAGVPKRASHVEAALV
GHSWSEAVFAAAKAEFARDFTPMSDMRASSDYRLEAAANMLTRYFEDLGQTSAPTHVLEV
K