Protein Info for HP15_2710 in Marinobacter adhaerens HP15

Annotation: L-lactate/malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00056: Ldh_1_N
  • amino acids 1 to 141 (141 residues), 120.5 bits, E=5.7e-39
• PF02866: Ldh_1_C
  • amino acids 144 to 298 (155 residues), 93 bits, E=2.3e-30

Best Hits

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 70% identity to ttu:TERTU_0352)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.1.27)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.27)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• heterolactic fermentation (14/18 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• methylglyoxal degradation V (2/3 steps found)
• L-histidine degradation V (1/2 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See E4PKJ8 at UniProt or InterPro

Protein Sequence (307 amino acids)

>HP15_2710 L-lactate/malate dehydrogenase (Marinobacter adhaerens HP15)
MKVSVIGTGNVGSTLAFVLTLKNIIDELVLVGRSKQSVLGDVLDLRHGQLFVNTPAQVTA
GTISDTAGSDVIAVCASVPTPKNMSSRLELAQGNVQLMKELMPELARMSPDCKIVMVSNP
VDVLVHYALEFGGFRPNQVIGTGTLVDSSRFRQLLAEELRIHSEDIRAYILGEHGDSQFP
AMSCADVGGETLDATPGRYALFERASRAGFEVLKHKGCTNYAVALAAAEIIECIANDSKH
TLPVSLRVDGFLGVDDVCLSLPAVVGRNGIERVLHPRLDEKEQAAFLHSANVVREVIASS
APEKEDH