Protein Info for Psest_2820 in Pseudomonas stutzeri RCH2

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase" amino acids 10 to 229 (220 residues), 238.6 bits, see alignment E=2.7e-75 PF12804: NTP_transf_3" amino acids 11 to 134 (124 residues), 37.3 bits, see alignment E=3.3e-13 PF01128: IspD" amino acids 11 to 226 (216 residues), 222.7 bits, see alignment E=5.3e-70

Best Hits

Swiss-Prot: 75% identical to ISPD_PSEE4: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 83% identity to psa:PST_1559)

MetaCyc: 50% identical to 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase. [EC: 2.7.7.60]

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPL8 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Psest_2820 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Pseudomonas stutzeri RCH2)
MTQRKLPAFWVVIPAAGVGSRMRADRPKQYLQLGGRSIIEHTLDCFLDHPTLAGVTVCIA
PNDPYWPNLPCASDPRIQRAPGGRERCDSVLNGLRRLGELGANEQDWVLVHDAARPNLAR
EDLDRLLLELADDSVGGLLAVPARDTLKRVGLDGRVVETVDRSVIWQAFTPQMFRLGMLR
DALEGALEAAALVTDEASALEWAGHAPKVVEGRADNLKVTRPEDLDWLEQRWSGGRVE