Protein Info for PGA1_c28080 in Phaeobacter inhibens DSM 17395

Annotation: putative acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF13302: Acetyltransf_3" amino acids 7 to 150 (144 residues), 25.6 bits, see alignment E=4.7e-09 PF13673: Acetyltransf_10" amino acids 32 to 157 (126 residues), 48.1 bits, see alignment E=2.9e-16 PF00583: Acetyltransf_1" amino acids 59 to 150 (92 residues), 58.5 bits, see alignment E=2e-19 PF13508: Acetyltransf_7" amino acids 63 to 150 (88 residues), 48.1 bits, see alignment E=3.1e-16 PF08445: FR47" amino acids 95 to 158 (64 residues), 28.9 bits, see alignment E=2.4e-10

Best Hits

KEGG orthology group: None (inferred from 57% identity to rsp:RSP_0613)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3X1 at UniProt or InterPro

Protein Sequence (176 amino acids)

>PGA1_c28080 putative acetyltransferase, GNAT family (Phaeobacter inhibens DSM 17395)
MTDHPDLTLRVADMEDASSLAALSLEVWVGTYLREGVSGFFADYALAELTVARFETHLAN
PQEHFIVSQNRVGIDGYIRLSRGSLGPVPGCSDVEITTLYVQPRHHGRGIGTALLRAALA
HCAEEGAARVWLASNAENTPAKAFYLSQGFDRVGETQFVIDDQSYLNDVFARDCLG