Protein Info for PGA1_c28070 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator, marR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 221 to 238 (18 residues), see Phobius details PF13412: HTH_24" amino acids 23 to 65 (43 residues), 38.9 bits, see alignment 1e-13 PF12802: MarR_2" amino acids 25 to 72 (48 residues), 31.6 bits, see alignment 3e-11 PF01047: MarR" amino acids 25 to 67 (43 residues), 26.8 bits, see alignment 8e-10 PF00480: ROK" amino acids 92 to 379 (288 residues), 60.9 bits, see alignment E=3.1e-20

Best Hits

KEGG orthology group: None (inferred from 58% identity to sit:TM1040_0367)

Predicted SEED Role

"Transcriptional regulator FrcR for fructose utilization, ROK family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQ99 at UniProt or InterPro

Protein Sequence (400 amino acids)

>PGA1_c28070 putative transcriptional regulator, marR family (Phaeobacter inhibens DSM 17395)
MEQEQARSLSGGVNQTGVRVFNERLILSLLQRNGAMPGSALARGTGLSPQTVSVILRKLE
ADGLLQRGETQRGRVGKPSVPMGLNPDGLFSYGLKIGRRSVEVLLMDVCGAVRQQLRLRY
PYPTPAVVFDFLRDSMRQIEAALPADLHPRICGIGVAAPFQLWTWHAQINAPAEALADWQ
TVDFTSEIARFSALPVHVVNDATAACRAEHMYGRGKAYRDYAYFFVGAFIGGGVVLNHRV
LEGNQGNAGALGSLSTLGPEGREAKLLDLASIHLLEQRLRDAGKDPGQLWQLPMHWSGFD
AEVTPWLDQAADAIARASLATCAVIDFEAVLIDGALPDSIRAALVERTRAALSNLDARGL
IPPHIECGAIGPNARAIGAASGPIISQYLLDTNSVFNAAL