Protein Info for PGA1_c28050 in Phaeobacter inhibens DSM 17395

Annotation: putative sugar transport system, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 67 to 93 (27 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 71 to 342 (272 residues), 154.5 bits, see alignment E=1.6e-49

Best Hits

Swiss-Prot: 74% identical to FRCC_RHIML: Fructose import permease protein FrcC (frcC) from Rhizobium meliloti

KEGG orthology group: K10553, fructose transport system permease protein (inferred from 89% identity to sit:TM1040_0369)

Predicted SEED Role

"Fructose ABC transporter, permease component FrcC" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTQ9 at UniProt or InterPro

Protein Sequence (353 amino acids)

>PGA1_c28050 putative sugar transport system, permease protein (Phaeobacter inhibens DSM 17395)
MTTPQSYEAAASGSPEAVADFDQGETSFISRFQHMLHVTPSLVPLIVLVLSVIVFGLLLG
SKFFSPFALTLILQQVGIVGIVACAQSLVILTAGIDLSVGAIMVLSSVVMGQFTFRYGLP
PEVAVACGLICGTICGFINGWLVARMKLPPFIVTLGMWQIVLASNFLYSANETIRSQTIA
AEAPLLQLFGEKIKIGGAVFTYGVIFMVILVVLLAYVLRHTAWGRHVYAVGDDPEAAELS
GVKVTRVLISVYMLSGLICAFAGWAMIGRIGSVSPTSGQLANIESITAVVIGGISLFGGR
GSILGTFFGALIVGVFTLGLRLLGADAQWTYLLIGLLIIAAVAVDQWIRKVSV