Protein Info for PGA1_c28040 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00005: ABC_tran" amino acids 20 to 178 (159 residues), 104.4 bits, see alignment E=7.6e-34

Best Hits

Swiss-Prot: 78% identical to FRCA_RHIML: Fructose import ATP-binding protein FrcA (frcA) from Rhizobium meliloti

KEGG orthology group: K10554, fructose transport system ATP-binding protein (inferred from 87% identity to sit:TM1040_0370)

Predicted SEED Role

"Fructose ABC transporter, ATP-binding component FrcA" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F290 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_c28040 ABC transporter ATP-binding protein (Phaeobacter inhibens DSM 17395)
MEPILKARGLVKRYGRVTALDHCDFDLMPGEILAVIGDNGAGKSSLIKAVSGAVVPDAGE
VWLEGRRVQFHTPIDARKEGIETVYQTLAMSPALSIADNMFMGRELRKPGWRGSVLRQLD
RARMEQIARDKLNELGLATIQNINQAVETLSGGQRQGVAVARAAAFGSKVIILDEPTAAL
GVKESRRVLELIQDVKSRGIPIILISHNMPHVFEVADRIHVHRLGKRLCVIDPKQHSMSD
AVGYMTGAQVPSEDLTAA