Protein Info for PGA1_c28030 in Phaeobacter inhibens DSM 17395

Annotation: Panthothenate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03308: MeaB
  • amino acids 18 to 63 (46 residues), 24.7 bits, 1.7e-09
• PF00485: PRK
  • amino acids 29 to 166 (138 residues), 27 bits, E=5.9e-10
• PF13238: AAA_18
  • amino acids 29 to 174 (146 residues), 30.1 bits, E=9e-11

Best Hits

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 65% identity to sit:TM1040_0371)

Predicted SEED Role

No annotation

MetaCyc Pathways

• D-sorbitol degradation I (3/3 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• mannitol cycle (3/5 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.4

Use Curated BLAST to search for 2.7.1.4

Sequence Analysis Tools

See I7E3W7 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PGA1_c28030 Panthothenate kinase (Phaeobacter inhibens DSM 17395)
MTREVTSLADLVAQVQALPVAEGRARRLVALAGAPGSGKSTLAELLVRALCAQGTSAAVV
PMDGFHLDNRLLSEMDLLARKGAPESFDQPGFLRLIAAMAVEEEVIYPEFDRARDIAIAG
AARVDAGVEVAVVEGNYLMFDAPGWRDLAALWDVSVRVDVPRDILRERLVARWQAYGLSD
AEAEERAEGNDLANADRVAAAALPADVIWKGETE