Protein Info for Psest_0277 in Pseudomonas stutzeri RCH2

Annotation: non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family" amino acids 6 to 195 (190 residues), 186.2 bits, see alignment E=1.9e-59 PF01725: Ham1p_like" amino acids 7 to 193 (187 residues), 214.2 bits, see alignment E=7.6e-68

Best Hits

Swiss-Prot: 82% identical to IXTPA_PSEAE: dITP/XTP pyrophosphatase (PA0387) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 96% identity to psa:PST_3973)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDR4 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Psest_0277 non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family (Pseudomonas stutzeri RCH2)
MMPFSELVLASHNAGKLKELQAMLGNAVRVRSVAEFSDIEPEETGLSFIENAILKARNAA
RLSGLPALADDSGLAVDALGGAPGIYSARYADGQGDAANNAKLLQVLRDVPDAERGAQFV
CALALVRHANDPLPIICEGLWQGRILHAARGEHGFGYDPLFWVPECECSSAELPAAQKNQ
LSHRARAMALLKQRLGI