Protein Info for PGA1_c02880 in Phaeobacter inhibens DSM 17395

Annotation: uvrABC system protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 TIGR00194: excinuclease ABC subunit C" amino acids 27 to 604 (578 residues), 558.3 bits, see alignment E=1.1e-171 PF01541: GIY-YIG" amino acids 35 to 109 (75 residues), 30.4 bits, see alignment E=1e-10 PF02151: UVR" amino acids 221 to 252 (32 residues), 31.6 bits, see alignment (E = 2.7e-11) PF08459: UvrC_RNaseH_dom" amino acids 398 to 559 (162 residues), 174.1 bits, see alignment E=5e-55 PF14520: HHH_5" amino acids 575 to 624 (50 residues), 37.3 bits, see alignment 7.6e-13 PF12826: HHH_2" amino acids 578 to 627 (50 residues), 30.6 bits, see alignment 7.5e-11

Best Hits

Swiss-Prot: 85% identical to UVRC_RUEPO: UvrABC system protein C (uvrC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 85% identity to sil:SPO3637)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLJ5 at UniProt or InterPro

Protein Sequence (629 amino acids)

>PGA1_c02880 uvrABC system protein C (Phaeobacter inhibens DSM 17395)
MTDHQPDTSPETARPTHRTGYAVIQDYLKTLDSSPGVYRMLDSESRVLYVGKARNLRARV
SNYSRPGHSPRIERMIAATASMMFLTTRTETEALLLEQNLIKQLKPKYNVLLRDDKSFPN
ILVAKDHAFPQIKKHRGTRREKGSYFGPFASAGAVNRTLNQLQKAFLLRNCTNAMFESRT
RPCLQYQIKRCTAPCTGEISAEDYASSVRDAERFLSGRSTKIQEELAEQMAAASEAMEFE
RAAALRDRIKALTQVQTSQGINPRGVAEADVIGLHLDSGQACVQVFFIRANQNWGNQDFY
PRINGDVSPAEVMEAFIGQFYDNKEPPRQLILSDEIENGDLMEQALSDKAGRRVEILVPQ
RGEKTELVAGAVRNARESLARRMAESATQAKLLRGVAEAFGLEGPPQRIEVYDNSHIQGS
HAVGGMIVAGPEGFMKNAYRKFNIRGDDLTPGDDFGMMKEVLNRRFSRLLKEDPDREKGL
WPDLLLIDGGAGQVSAVAEIMAEHGVQDIPMIGVAKGVDRDHGKEEFHRLGAPAFALQRN
DPVLYFVQRMRDEAHRFAIGTHRAKRAKAMGATPLDEVPGVGAARKRALLAHFGSAKAVS
RANLSDLKAVEGVSAALAQRIYDFFHAQG