Protein Info for Psest_2808 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 25 to 35 (11 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 151 to 184 (34 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF04018: VCA0040-like" amino acids 14 to 257 (244 residues), 345.5 bits, see alignment E=9.8e-108

Best Hits

KEGG orthology group: K08974, putative membrane protein (inferred from 95% identity to psa:PST_1570)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKN0 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Psest_2808 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MKNALLLYAKGMAMGAADVVPGVSGGTVAFITGIYDELLRSISAVPYAVRPLLRGRLGEA
WKTANASFLLVLFAGVLTSILSLARLITFLLEEHPIPVWSFFFGLILVSVHLVGKEIQRR
NLSRLVSFCLGIGFAYWITVAAPVQWGSSSLSLFFAGAIAICAMILPGISGSFILVLLGL
YPVVLGAVRSFDIGVMGIFAAGCMVGLLSFAKFLSWLLKRWRDLTLAFLTGLMLGSLNKV
WPWKETLTWRTNSSGENVPVLQQNLLPGAYADLTGQDPQLLAAVLLALGGIVLVLGLEWF
AGRRQPMTEGV