Protein Info for PGA1_c27940 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): N-Acetyl-D-glucosamine ABC transport system, permease component 1
Rationale: Specific phenotypes on N-Acetyl-D-Glucosamine. (SEED_correct)
Original annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 162 to 187 (26 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 303 (215 residues), 46.4 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 88% identity to sil:SPO1838)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 1" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F282 at UniProt or InterPro

Protein Sequence (308 amino acids)

>PGA1_c27940 N-Acetyl-D-glucosamine ABC transport system, permease component 1 (Phaeobacter inhibens DSM 17395)
MQNTPHKPRRRWHIAVFLAPAVLVYTAIMIFPLFNTLRLALYSESDQIRQFVGLANFETL
FGNPNWSEQFWNALGNNFWFFFVHMLVQNPIGVALAAILSHPRLRFAALYRTAIFVPTIL
SFVIVGFAWKLILSPIWGITPDLLDAIGLKWLFAPWLGKEDYALTTLALISVWQFVGIPM
MLIYAALLSIPEEVIEAGEVDGITGMSAFWKIKLPLILPSIGIISILTFVGNFNAFDLIY
TTQGALAGPDFSTDILGTFMYRTFFGFQLQLGDPHMGSAIATAMFAIILIGVCIYLFGIQ
TRLRRYQF