Protein Info for HP15_2695 in Marinobacter adhaerens HP15

Updated annotation (from data): Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)
Rationale: Specifically important for: L-Phenylalanine. The second SEED annotation (beta-ketoadipyl-CoA thiolase) is part of phenylalanine catabolism via phenylacetate. Not clear if the acetyl-CoA acetyltransferase annotation is correct, so it was removed, but it remains plausible (SEED_correct)
Original annotation: acetyl-CoA acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02430: 3-oxoadipyl-CoA thiolase
  • amino acids 8 to 411 (404 residues), 727.5 bits, E=4.1e-223
• PF00108: Thiolase_N
  • amino acids 11 to 271 (261 residues), 249.7 bits, E=4.9e-78
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 12 to 409 (398 residues), 454.4 bits, E=3.1e-140
• PF00109: ketoacyl-synt
  • amino acids 95 to 132 (38 residues), 23.7 bits, 5e-09
• PF02803: Thiolase_C
  • amino acids 281 to 410 (130 residues), 152.3 bits, E=7e-49

Best Hits

Swiss-Prot: 69% identical to PCAF_ACIAD: Beta-ketoadipyl-CoA thiolase (pcaF) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 76% identity to pmk:MDS_2865)

MetaCyc: 74% identical to beta-ketoadipyl-CoA thiolase (Pseudomonas sp. Y2)
RXN0-6512 [EC: 2.3.1.223]; 3-oxoadipyl-CoA thiolase. [EC: 2.3.1.223, 2.3.1.174]

Predicted SEED Role

"Acetyl-CoA acetyltransferase (EC 2.3.1.9) @ Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" (EC 2.3.1.-, EC 2.3.1.9)

MetaCyc Pathways

• oleate β-oxidation (30/35 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)
• superpathway of phenylethylamine degradation (10/11 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (5/5 steps found)
• adipate degradation (5/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• adipate biosynthesis (4/5 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• ketolysis (2/3 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• 3-oxoadipate degradation (1/2 steps found)
• acetoacetate degradation (to acetyl CoA) (1/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• valproate β-oxidation (6/9 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• ketogenesis (3/5 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• glycerol degradation to butanol (10/16 steps found)
• isopropanol biosynthesis (engineered) (2/5 steps found)
• pyruvate fermentation to acetone (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• catechol degradation III (ortho-cleavage pathway) (2/6 steps found)
• 4-oxopentanoate degradation (4/9 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• 4-methylcatechol degradation (ortho cleavage) (2/7 steps found)
• superpathway of salicylate degradation (2/7 steps found)
• L-lysine fermentation to acetate and butanoate (4/10 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• 2-methylpropene degradation (2/8 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (1/7 steps found)
• mevalonate pathway II (haloarchaea) (1/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• aromatic compounds degradation via β-ketoadipate (2/9 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• isoprene biosynthesis II (engineered) (1/8 steps found)
• mevalonate pathway III (Thermoplasma) (1/8 steps found)
• mevalonate pathway IV (archaea) (1/8 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• L-tryptophan degradation III (eukaryotic) (5/15 steps found)
• toluene degradation III (aerobic) (via p-cresol) (2/11 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (5/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (5/17 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• toluene degradation VI (anaerobic) (4/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)
• superpathway of ergosterol biosynthesis I (3/26 steps found)
• superpathway of L-lysine degradation (12/43 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)
• superpathway of cholesterol biosynthesis (3/38 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Fatty acid metabolism
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Tryptophan metabolism
• Tyrosine metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.9

Use Curated BLAST to search for 2.3.1.- or 2.3.1.174 or 2.3.1.223 or 2.3.1.9

Sequence Analysis Tools

See E4PKI3 at UniProt or InterPro

Protein Sequence (415 amino acids)

>HP15_2695 Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) (Marinobacter adhaerens HP15)
MSADNILKDAYIVDAIRTPIGRYGGALSAVRADDLGAIPIKALAERYPDLDWSKIDDVLY
GCANQAGEDNRDVARMSLLLAGLPVDVPGSTINRLCGSGMDAVGSAARAIRTGETQLMIA
GGVESMSRAPFVMGKADSAFSRKAEIFDTTIGWRFVNPVLKKQYGIDSMPETAENVAADF
GISREDQDAFALRSQQRTAAAQKEGRLAAEITPVTIPRRKQDPLVVDTDEHPRETSLEKL
ASLPTPFRENGTVTAGNASGVNDGACALLLAGADALKQYNLKPRARVVAMATAGVEPRIM
GFGPAPATRKVLATAGLELADMDVIELNEAFAAQALAVTRDLGLPDDAEHVNPNGGAIAL
GHPLGMSGARLVTTALNELERRHAAGQKARYALCTMCIGVGQGIALIIERMDAVA