Protein Info for PGA1_c27930 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): N-Acetyl-D-glucosamine ABC transport system, periplasmic substrate-binding component
Rationale: Specific phenotype on N-Acetyl-D-Glucosamine. (SEED_correct)
Original annotation: putative sugar ABC transporter, periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01547: SBP_bac_1" amino acids 37 to 325 (289 residues), 104.5 bits, see alignment E=1.1e-33 PF13416: SBP_bac_8" amino acids 44 to 332 (289 residues), 103.7 bits, see alignment E=1.6e-33

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 82% identity to sil:SPO1839)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, sugar-binding protein" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3W0 at UniProt or InterPro

Protein Sequence (417 amino acids)

>PGA1_c27930 N-Acetyl-D-glucosamine ABC transport system, periplasmic substrate-binding component (Phaeobacter inhibens DSM 17395)
MTRKLFTLALLGSTMIGGAAAAEDVTLTIESWRNDDLALWQDKIIPAFEAANPGIKLKFT
PSAPAEYNAVLNSKLDAGSAGDLITCRPFDASLGLYDKGQLADLSDLDAMGSFSNVAKSA
WQTDDGSATFCVPIASVIHGFIYNKDAFAELGVNVPETEDEFFAALEKIKEDGNYVPLAM
GTNDQWEAATMGYNNIGPNYWKGEEGRLALIAGEQKLTDDQWVAPYETLSKWGAYMGDGY
EAQTYPDSQNIFTLGRAAIYPAGSWEISGFNTQADFAMGAFKPPVKAAGDTCYISDHTDI
AVGLNAASPNAEAAKTFLNWVGSAEFASIYANALPGFFSLSNHEVAMEDPLAQEFVSWRG
ECESTIRSTYQILSRGTPNLENETWGASVAAIKGTKAPADLGAELQEGLASWYEPQK