Protein Info for PGA1_c27910 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): N-acetylglucosamine kinase (EC 2.7.1.59)
Rationale: Specifically important for: D-Glucose; N-Acetyl-D-Glucosamine. This is the first step in NAG catabolism. The next step is expected to be N-acetylglucosamine-6-phosphate deacetylase (PGA1_c27880, no data). The phenotype on D-glucose is consistent across replicates and is not explained. It does not seem to be due to polar effects. There is a glucokinase that is important for glucose utilization (PGA1_c05420 ) so we don't expect that this is glucokinase. (SEED_correct)
Original annotation: putative ATPase, BadF/BadG/BcrA/BcrD type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 42% identity to jan:Jann_1358)

Predicted SEED Role

"N-acetylglucosamine kinase of eukaryotic type (EC 2.7.1.59)" in subsystem Chitin and N-acetylglucosamine utilization (EC 2.7.1.59)

MetaCyc Pathways

N-acetylglucosamine degradation II (3/3 steps found)
chitin derivatives degradation (3/8 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZT8 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PGA1_c27910 N-acetylglucosamine kinase (EC 2.7.1.59) (Phaeobacter inhibens DSM 17395)
MTDSRFPYLIAVDGGGTSCRFALLKSGATPPQQLVVTGGSANVYTAPDQAVETLSAGLAD
LQRQSGLTDEVFHQIPVYAGLAGVIDGESAARVAEALPQAHVRVEDDRMPAVVGALGEDT
ASLIGVGTGSFLGRQVAGQVTLIGGHGTVLGDEASGGWLGRRALQLTLQAAEGIEPMTPL
LRSCLRDFSNETAKIVRFAQTARPVAFGAYAPRVAKAAVEGDAAGRRLMAEGAEYLCNGL
QALGRRPEEPVYHIGGVAAQYAAYLPADVADYLRGAEGSPLDGALELARRFAREIAQEVV