Protein Info for PGA1_c27880 in Phaeobacter inhibens DSM 17395

Annotation: N-acetylglucosamine-6-phosphate deacetylase NagA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00221: N-acetylglucosamine-6-phosphate deacetylase
  • amino acids 10 to 376 (367 residues), 284.6 bits, E=5.8e-89
• PF01979: Amidohydro_1
  • amino acids 57 to 370 (314 residues), 59.1 bits, E=2.4e-20

Best Hits

Swiss-Prot: 42% identical to AGAA2_SHESA: N-acetylgalactosamine-6-phosphate deacetylase (agaAII) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 67% identity to sil:SPO1844)

MetaCyc: 42% identical to N-acetylgalactosamine-6-phosphate deacetylase (Shewanella sp. ANA-3)
N-acetylglucosamine-6-phosphate deacetylase. [EC: 3.5.1.25]

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (1/4 steps found)
• peptidoglycan recycling I (8/14 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• N-acetyl-D-galactosamine degradation (1/5 steps found)
• chitin derivatives degradation (3/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

See I7E3V5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>PGA1_c27880 N-acetylglucosamine-6-phosphate deacetylase NagA (Phaeobacter inhibens DSM 17395)
MTEDVHPLRALTGARILTPVGWEDDFALVLRGDQIAAVLPMGKLPEGAELTELDGGILTA
GFVDLQVNGGGGVMFNDAPDLEQLQVIAAAHAKIGATSILPTLITDTPNFVARAIEATVE
AIAAGVPGIIGLHLEGPHLAVSRKGAHDASLIRPMSETDLEMLCAAASRLPVLKVTLACE
AATPAQIRQLSEAGVLVSLGHTDASHADCVAAVAAGARCVTHLFNAQSQLGNREPGVVGA
ALDLGGLSAGLIADGVHVHPASIRAALAAKTGPGQVFLVSDSMATGGSDIDHFTLNGREI
RRYDNRLTLADGTLAGAHLELATAVKTLVEGCEVALETALEMASARPADLIGRSDLGRLH
PGARADVLHLNDALELQQVWQSGLAL