Protein Info for PGA1_c27870 in Phaeobacter inhibens DSM 17395

Annotation: CoA-transferase, family III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF02515: CoA_transf_3" amino acids 4 to 365 (362 residues), 412.3 bits, see alignment E=1e-127

Best Hits

Swiss-Prot: 40% identical to ACOCT_ACEAC: Acetyl-CoA:oxalate CoA-transferase (uctC) from Acetobacter aceti

KEGG orthology group: None (inferred from 87% identity to sit:TM1040_0389)

MetaCyc: 57% identical to succinate--lglutarate CoA-transferase (Agrobacterium fabrum C58)
Succinate--hydroxymethylglutarate CoA-transferase. [EC: 2.8.3.13]

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQ85 at UniProt or InterPro

Protein Sequence (375 amino acids)

>PGA1_c27870 CoA-transferase, family III (Phaeobacter inhibens DSM 17395)
MTPLAGLKVVELARILAGPWIGQSLADLGAEVIKVESPEGDDTRRWGPPFIERDGDKTAA
YYYAANRGKSCVTADFRTKDGKQTVLELIRDADILIENFKVGGLAKYGLDYDSLKAVNPR
LIYCSVTGFGQDGPYAARAGYDFLLQGMSGLMSITGAPEGEPQKVGVAITDIVTGLYGTI
GILAAVEQRHSTGRGQHIDMSLLDCATAVLANQNMNYLATGTSPTRMGNEHPNIAPYQVM
AVRDGHVILAVGNDGQFARLCAVLNMAGLADDPRFASNQLRVANRVELTPMLAAALAQWG
QADLLAALEAATVPAGPINTIGQAFDDPQIKHRQMQIAPEDVPGVRGPWVFSDAELALEK
SAPILPVAQDMSQGD