Protein Info for Psest_2796 in Pseudomonas stutzeri RCH2

Annotation: HNH endonuclease.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF01844: HNH" amino acids 29 to 77 (49 residues), 47.9 bits, see alignment E=6e-17

Best Hits

Swiss-Prot: 57% identical to YAJD_SALTI: Putative HNH nuclease YajD (yajD) from Salmonella typhi

KEGG orthology group: None (inferred from 98% identity to psa:PST_1581)

Predicted SEED Role

"putative cytoplasmic protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNB9 at UniProt or InterPro

Protein Sequence (114 amino acids)

>Psest_2796 HNH endonuclease. (Pseudomonas stutzeri RCH2)
MSTSKPTTPYSQREQGYREKALKMYPWVCGRCAREFSGKRLSELTVHHKDHNHDNNPEDG
SNWELLCLYCHDNEHSRYTDNQYQAEARPGSDLGPKETFKAFANLADLLKGKQG