Protein Info for Psest_2794 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details PF00892: EamA" amino acids 6 to 130 (125 residues), 53.6 bits, see alignment E=1.4e-18 amino acids 141 to 279 (139 residues), 60.5 bits, see alignment E=1e-20

Best Hits

Swiss-Prot: 56% identical to EAMA_SALTY: Probable amino-acid metabolite efflux pump (eamA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03298, drug/metabolite transporter, DME family (inferred from 94% identity to psa:PST_1584)

MetaCyc: 52% identical to cysteine/O-acetylserine exporter EamA (Escherichia coli K-12 substr. MG1655)
RXN0-1923; RXN0-1924

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPJ4 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Psest_2794 Predicted permease, DMT superfamily (Pseudomonas stutzeri RCH2)
MSPRDLLLALVVIIVWGMNFVVIMIGLHDVPPMLLGALRFMLAAVPAVFFIKRPQVPLRW
MLAYGLTISLGQFAFLFTAMKHGMPAGLASLVLQSQAFFTLFFAAMFLGERIRAANLLGL
LIAACGLALIGAQSGLGMTLSGFVLTICAASMWALGNIVTRKVGKVNLVGLVVWGSLVPP
LPFLALSLWLEGPQVIETALRGIGWQTILVLVYLAFGATILGYSLWSRLLSRYPANQVAP
FSLLVPVVGLTSASLLLGERLGALQLGGALLVMIGLAVNVCGGWLFGRLRLARA