Protein Info for HP15_2684 in Marinobacter adhaerens HP15

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 6 to 38 (33 residues), see Phobius details amino acids 46 to 70 (25 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 174 to 199 (26 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 324 to 351 (28 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details PF06808: DctM" amino acids 12 to 424 (413 residues), 287.2 bits, see alignment E=1e-89 TIGR00786: TRAP transporter, DctM subunit" amino acids 21 to 429 (409 residues), 367 bits, see alignment E=5.4e-114

Best Hits

KEGG orthology group: None (inferred from 79% identity to mme:Marme_0091)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKH2 at UniProt or InterPro

Protein Sequence (435 amino acids)

>HP15_2684 TRAP-type C4-dicarboxylate transport system, large permease component (Marinobacter adhaerens HP15)
MDIAFLSIVLAVAMILMLAVGVWVSLTLVGIGVLGLLLSGNDQIGLLFATSSWGASTSWS
LTALPMFIWMGEVLFRTRLSEDLFKGLAPWMGGLPGKLLHVNILSCGIFAAVSGSSAATA
ATIGRMTLPELKAQGYSDKMAVGTLAGSGTLGLLIPPSIILIVYGVAAEVSIGRLFIAGA
LPGLMLVAMFMGYTMIWAKLNKDQLPTTKKENLAFSVKIKALKMLLPIVGLIIFVLGSIY
TGFATPTEAAALGVFGALIIAAATGSLSIQSFKDSLLGAVKSSCMIGLILVGAHFLTLAM
GFLGIPRELAAWIGSMSLSPFELLVGLTVLFVLLGCFLDGISVVVLTVAVVMPMVQQAGI
DLLWFGIFIVLVVEMAQITPPVGFNLFVIQALTGKDILYVARAALPFFLLIMAALFLIGW
FPEIVTYLPQTMSQG