Protein Info for HP15_2683 in Marinobacter adhaerens HP15

Annotation: DctQ (C4-dicarboxylate permease, small subunit)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details PF04290: DctQ" amino acids 23 to 154 (132 residues), 79.2 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: None (inferred from 60% identity to mpc:Mar181_0222)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 5"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKH1 at UniProt or InterPro

Protein Sequence (172 amino acids)

>HP15_2683 DctQ (C4-dicarboxylate permease, small subunit) (Marinobacter adhaerens HP15)
MNSLREKFYLASGYAAGFCIALIMVVILAQIVGRLFGFIIPSAEDVSGWALAASTFFGLA
YTFHNGGHIRVTLVIQKWSARPRFWQELVVLIFGFALACYMTFYCWHMVWESYIFEEVSH
GYIPVPIWIPQVPVALGMTALNIAILDDLVAVIRKRTPSYQQHEDELNLEDV