Protein Info for PGA1_c27760 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00005: ABC_tran" amino acids 28 to 164 (137 residues), 81.7 bits, see alignment E=7.9e-27 PF13304: AAA_21" amino acids 126 to 195 (70 residues), 36.5 bits, see alignment E=6e-13

Best Hits

KEGG orthology group: K06857, putative tungstate transport system ATP-binding protein (inferred from 54% identity to rde:RD1_2910)

Predicted SEED Role

"ABC-type tungstate transport system, ATP-binding protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQ78 at UniProt or InterPro

Protein Sequence (241 amino acids)

>PGA1_c27760 ABC transporter ATP-binding protein (Phaeobacter inhibens DSM 17395)
MTGANTLFPLVVETAQVRRRGKTLIGPVDLRLDGQGTTIVIGPNGSGKTSLLKMLHGILR
LGQGRISWGCPMAEAQRRQAFVFQTPVMMRRSVVENIAYPLRLNRVSRKVALAEAEIWAE
RIGLGGDALQRPAVLLSGGERQKLALARALIRKPQLLFLDEPCASLDGRATREIEEILTE
AAASGTRLIMSTHNMGQAQRLADEVLFVLHGQIAEFSAAEAFFARPHTEQGRAFLRGDIV
E