Protein Info for HP15_2670 in Marinobacter adhaerens HP15

Annotation: RarD protein, DMT superfamily transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 149 to 165 (17 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details TIGR00688: protein RarD" amino acids 6 to 257 (252 residues), 214.9 bits, see alignment E=6.7e-68 PF00892: EamA" amino acids 6 to 140 (135 residues), 43.7 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 45% identical to Y195_VIBCH: Uncharacterized transporter VC_0195 (VC_0195) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 72% identity to maq:Maqu_0334)

Predicted SEED Role

"RarD protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJS0 at UniProt or InterPro

Protein Sequence (296 amino acids)

>HP15_2670 RarD protein, DMT superfamily transporter (Marinobacter adhaerens HP15)
MTDATKGVWYGLSAYTIWGCFPLFFALFEGVPAFEILIHRIIWSCVFLAVVISGLRRWPA
VRAALANPKQLWRVLACALLIAANWGIYIYSVETRHVLQASLGYFLTPLVNVALGMLVLR
ERMGPWQMAAVVLAGVGILIQLAMLGELPWISLALAMSFGTYGLVRKQVLLDGLSGLFVE
TMLLLPVGLLTFGWLASEGMSHFSDSAYIGSLLMASGIVTAIPLLLFAGAARRLRLATVG
FLMYINPTLQFFIALLVFGEPLSDAQLTSFVVIWIALGLYSWSSWHYRPRVPVGQD