Protein Info for Psest_2779 in Pseudomonas stutzeri RCH2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 176 to 202 (27 residues), see Phobius details PF13675: PilJ" amino acids 43 to 143 (101 residues), 79.8 bits, see alignment E=2.5e-26 PF00672: HAMP" amino acids 199 to 246 (48 residues), 25.8 bits, see alignment 1.6e-09 PF00015: MCPsignal" amino acids 312 to 495 (184 residues), 154.3 bits, see alignment E=4.6e-49

Best Hits

KEGG orthology group: None (inferred from 93% identity to psa:PST_1597)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPH8 at UniProt or InterPro

Protein Sequence (531 amino acids)

>Psest_2779 Methyl-accepting chemotaxis protein (Pseudomonas stutzeri RCH2)
MTSTLANVIQALLRGLGLRTINHQFFFSYSLIFFCAALTAGVLFMSSKDASQIDMAGAQR
MLSQKMMKEALLAAQGIGSPADVDKTIQRFEQSHRLLLNGDRAQGIAPVELASAKPHLQR
VDQIWQRYRPAVQALAAGQSADVKAIATDSNDILAAANEVVSLISAEANRSASQQLWVAL
GSTLCILLLVILGRIAGMNWLMLQIDELRGRLEKVSQGDFSAPLQVRHADDEMGMITLAY
NRLLGQVGEMIKGVRQAADDADAQCVRMAGLAGDSARNVEGQQAEIDQVATAMNEMLATS
HEVARSTVEAANAADVAEQETNAGSTVMNESVGAIRTLSGHVDGLSDVMQQLVQDSHEIG
KVLNVISGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTQSSAKEVGVLVE
RLQSQATRAGHAMDASRQSSATTLTQIEAAQHALGQIVGAVQTIRGMTNQIATAAEEQSQ
VAEDMNQSLTRIAQVADQAAGVTQDTAASGNTIMQSMKGLKSLTGRFRLES