Protein Info for HP15_2669 in Marinobacter adhaerens HP15

Annotation: alpha/beta hydrolase fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 50 to 287 (238 residues), 88.9 bits, E=6.4e-29
• PF12146: Hydrolase_4
  • amino acids 51 to 178 (128 residues), 31.9 bits, E=1.3e-11
• PF12697: Abhydrolase_6
  • amino acids 51 to 294 (244 residues), 64.7 bits, E=3e-21

Best Hits

Swiss-Prot: 58% identical to DHMA_PSYCK: Haloalkane dehalogenase (dhmA) from Psychrobacter cryohalolentis (strain K5)

KEGG orthology group: K01563, haloalkane dehalogenase [EC: 3.8.1.5] (inferred from 78% identity to abo:ABO_2415)

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-) / domain of unknown function" in subsystem tRNA processing (EC 3.5.4.-)

MetaCyc Pathways

• 1,2-dichloroethane degradation (1/4 steps found)
• γ-hexachlorocyclohexane degradation (5/11 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Atrazine degradation
• Naphthalene and anthracene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-, 3.8.1.5

Use Curated BLAST to search for 3.5.4.- or 3.8.1.5

Sequence Analysis Tools

See E4PJR9 at UniProt or InterPro

Protein Sequence (303 amino acids)

>HP15_2669 alpha/beta hydrolase fold protein (Marinobacter adhaerens HP15)
MNNKASSMDFVRTPEKRFERLLDYPFEPHYVEVDGLRMHYVDEGPADASPVLMMHGEPSW
SYLYRHMIPICAAAGHRVIAPDLIGFGKSDKPTSLDDYSYQQHMDWMQSFLDQLGLTNIT
LVCQDWGSLLGLRLAAENPERFLAIVVGNGMLPTGDQKAPPAFKIWKNFALHSPWFPIAR
IINTGSFRKLGPDEMRAYDAPFPGKKYKAGARAFPRLVPMHPDDPASEANRNAWKVLERW
EKPFLTTFSNGDPITRGGDAYMQKRIPGAKDQPHVTLKGGHFLQEDSPVPFARAINDLLA
TLS