Protein Info for PGA1_c27630 in Phaeobacter inhibens DSM 17395

Annotation: putative formate dehydrogenase gamma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 132 to 150 (19 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 165 to 393 (229 residues), 135.8 bits, see alignment E=9.7e-44 PF01292: Ni_hydr_CYTB" amino acids 167 to 370 (204 residues), 70.5 bits, see alignment E=8e-24

Best Hits

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 75% identity to sit:TM1040_0403)

Predicted SEED Role

"Formate dehydrogenase -O, gamma subunit (EC 1.2.1.2)" in subsystem Anaerobic respiratory reductases or Formate hydrogenase (EC 1.2.1.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F260 at UniProt or InterPro

Protein Sequence (414 amino acids)

>PGA1_c27630 putative formate dehydrogenase gamma subunit (Phaeobacter inhibens DSM 17395)
MLRIAFSILMQLTLMAGIAAAQDAPDAPAANTVPDRSATGGAQTLEDILARQRGEKIDDS
FRSDDTGAAALGAGLTEQLGTLGGASDPELWRAIRYNAADLRVSAGGDVATVLVQDGGMR
WLTFREGPLRTYGGWLLLGTIAALALFYLLRGRIRIDEPATGRSVTRFQFIERFAHWMLA
GSFILLGLTGLASLFGRMVIAPYLGKEINAGLLIWSKWVHNNVSWAFMLALVMVFVMWVA
HNIPNRTDLVWIRQMGGIVGKSHPPAKKFNFGQKLIFWSVIVFGASISLSGLSLLFPFEI
QLFAKTFGILNDLGLPQLVGYGTLPVELAPQEEMQLAQSWHAILSFVLMAIILAHIYIGS
LGMEGAFDAMGSGDVDEAWAHQHHSLWLDEMREKGEVTPDGTSSGGAKGATPAE