Protein Info for PGA1_c27620 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome c-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00400: WD40" amino acids 35 to 67 (33 residues), 24.1 bits, see alignment (E = 6.4e-09) amino acids 75 to 105 (31 residues), 17.7 bits, see alignment (E = 6.6e-07) amino acids 118 to 146 (29 residues), 21.1 bits, see alignment (E = 5.3e-08) PF00034: Cytochrom_C" amino acids 338 to 434 (97 residues), 33.2 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: K08738, cytochrome c (inferred from 60% identity to sit:TM1040_0404)

Predicted SEED Role

"WD domain/cytochrome c family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3T9 at UniProt or InterPro

Protein Sequence (440 amino acids)

>PGA1_c27620 cytochrome c-like protein (Phaeobacter inhibens DSM 17395)
MSALADVSRKTCAICGAAALSLMVVGGHVDADEFTTLKGHGGPVMALAVSPEGQVATGSF
DNAIGLWRDRSPRWLEAHEAAVTALAFMDAGRLVSAGDDFALYLWPQGSNTGELIGRHLG
KIRALAVTPDRDTLVSGSWDGEIGLWPLGDGSEQRIKVGSGVNDVAVGADGAVYAATMSG
QILVYEDADRSPRRLVDQGFGINQLVLGPDGDWLAYGAVDGATRIVDSQTGDPVADFTLE
RRPILAMAYHEGTARLAVGDGQGYIMMVDTETWRISADFRATRDGPVWALEFAPDGRTVW
AAGLDDLAYGWPVALMGETEAQMAGNRGFLTDPATMPNGERQFMRKCSICHALGAGASRK
AGPSLYNVFGRPAGTLAGYRYSEVLDGSDIIWGEATIDALFDLGPDHYIPGSKMPMQRIT
DPQDRRDLIAFLKRATKVEK