Protein Info for PGA1_c27610 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulatory protein, containing sigma-54 interaction domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00072: Response_reg" amino acids 23 to 132 (110 residues), 78 bits, see alignment E=2.4e-25 PF00158: Sigma54_activat" amino acids 164 to 326 (163 residues), 176.1 bits, see alignment E=2e-55 PF14532: Sigma54_activ_2" amino acids 164 to 330 (167 residues), 64.6 bits, see alignment E=5e-21 PF07728: AAA_5" amino acids 186 to 301 (116 residues), 31.7 bits, see alignment E=5.9e-11 PF07724: AAA_2" amino acids 187 to 282 (96 residues), 29.4 bits, see alignment E=3.1e-10 PF25601: AAA_lid_14" amino acids 331 to 389 (59 residues), 57 bits, see alignment E=5.8e-19 PF02954: HTH_8" amino acids 416 to 447 (32 residues), 36.9 bits, see alignment (E = 9.9e-13)

Best Hits

KEGG orthology group: None (inferred from 85% identity to sit:TM1040_0405)

Predicted SEED Role

"Sigma-54 dependent response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQ68 at UniProt or InterPro

Protein Sequence (453 amino acids)

>PGA1_c27610 transcriptional regulatory protein, containing sigma-54 interaction domain (Phaeobacter inhibens DSM 17395)
MTVLTTAPPPRDEYGENLAGASILVIDDEPGMRNFMTKILTPRCKRVEQAASAAEASNIL
DQAHFDLIILDNIMPGKTGLEWVQEQHKVGLFADTVLVTAYADLETAIQALRVGVADFVL
KPFRANQILNSVARALDRKHLRRENYLLKHALSAEGTAARGRLLGKSPAIQTARDMITRL
APLPTPVLFTGASGTGKEIAARTLHSLSDRAEKPFVAVNCAAIAPDRIAHELFGVVDAQD
RRQDGLFLYADGGTLFLDEVAQMPEQVQAALLRVLEDQRIRPVGAERDIPLNLRFLFATN
ADLEQAVSEGRFRADLYHRINVVNIQMPPLRERVEDIVELAALFMEQFSITLAMPALELD
ADTLLKFSRYHWPGNVRELRNLIERSVILGAFPEEFAGTGAVTGSAAMDTLDLVMQRHIM
HVLDACQGNRAEAARRLGVSRKTVDRKCASWGL