Protein Info for Psest_2771 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 20 to 21 (2 residues), see Phobius details transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details PF06912: DUF1275" amino acids 22 to 236 (215 residues), 147.3 bits, see alignment E=2.5e-47

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_1605)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN98 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Psest_2771 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MPIKYARRLTDRRRSAHSNRQLGLCLAFVAGAANAGGFIAVQQYTSHMTGIVSAMADNLA
LGATDLALAGFGALLSFVLGAMCSTLMINFSRRRRLHSQYALPLALEAALLLLFGILGAR
LMAVPGFFVPLTVVLLCFIMGLQNAIITKLSNAEVRTTHITGMVTDIGIELGRLIYFNRN
RHDDMPPVRANRQRLRINLLMVTSFFIGGLSGAVGFKHFGFLATAPLAGLLLALALVPMA
DDLLLGWRLWRRRR