Protein Info for HP15_2661 in Marinobacter adhaerens HP15

Updated annotation (from data): Citrate uptake transporter, substrate-binding component TctC
Rationale: Specifically important for citrate utilization.
Original annotation: tricarboxylic transport TctC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03401: TctC
  • amino acids 68 to 325 (258 residues), 78.1 bits, E=3.2e-26

Best Hits

KEGG orthology group: K07795, putative tricarboxylic transport membrane protein (inferred from 91% identity to maq:Maqu_2897)

Predicted SEED Role

"Tricarboxylate transport protein TctC"

Sequence Analysis Tools

See E4PJR1 at UniProt or InterPro

Protein Sequence (328 amino acids)

>HP15_2661 Citrate uptake transporter, substrate-binding component TctC (Marinobacter adhaerens HP15)
MTTMIIKRTLSFVAAAAVSMSAMAWQPSGKVECLAPADPGGGWDFTCRSVGNVLQDLGLV
DGSVQTVNMAGAGGGVAYAHTVSKRAEDNKLLVAASTATTTRLAQKQFPGMNADMVTWVG
ALGADYGIIAVGKNSEYQNLSELMAAVKANPKSVKFAGGSARGGWDHLKVLIAAKAAGAD
KLPSIPYLSYNNGGEAMSQVVGGQVDAFTGDISEATGFLESGDLRVVAVLAEERLPGKFS
DLPTAKEQGIDAVGPNWRGFYMPKGASEEAKSYWVEAVDTLYASEEWKKVMKSNGLIPFH
PPASQFDEFVRNQVQDIENLSREIGLLK