Protein Info for PGA1_c27580 in Phaeobacter inhibens DSM 17395

Annotation: putative short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 6 to 159 (154 residues), 48.8 bits, E=2e-16
• PF00106: adh_short
  • amino acids 8 to 186 (179 residues), 154.6 bits, E=5.9e-49
• PF01370: Epimerase
  • amino acids 9 to 160 (152 residues), 22 bits, E=2.4e-08
• PF13561: adh_short_C2
  • amino acids 11 to 187 (177 residues), 112.3 bits, E=7.1e-36
• PF13460: NAD_binding_10
  • amino acids 11 to 146 (136 residues), 31.7 bits, E=3.5e-11

Best Hits

KEGG orthology group: None (inferred from 63% identity to sit:TM1040_0408)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See I7F255 at UniProt or InterPro

Protein Sequence (243 amino acids)

>PGA1_c27580 putative short chain dehydrogenase (Phaeobacter inhibens DSM 17395)
MFAGQTWWIVGASEGLGRAIAQKLDAAGARLVLSARSEERLQDLAGELGNATALPLDVTD
SDAISAAVAQIGKVDGILYCAGAYDPMPAQEWDADKVELICDVNFMGAIRVVGRVVPQMV
AANEGHIVLIGSLAGHTGLPGATGYGASKSAVMHMAENLQADLFQTPVKIQVINPGFIKT
RLTEKNDFDMPMIQTPDEAAEACIKAMKNGRFSTSFPTPFAWVFTIGKHLPRKLFLRLMG
AGK