Protein Info for HP15_2660 in Marinobacter adhaerens HP15

Updated annotation (from data): Citrate uptake transporter, small transmembrane component TctB
Rationale: Specifically important for citrate utilization.
Original annotation: tricarboxylic transport membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details PF07331: TctB" amino acids 8 to 141 (134 residues), 80.7 bits, see alignment E=6e-27

Best Hits

KEGG orthology group: K07794, putative tricarboxylic transport membrane protein (inferred from 90% identity to maq:Maqu_2896)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJR0 at UniProt or InterPro

Protein Sequence (148 amino acids)

>HP15_2660 Citrate uptake transporter, small transmembrane component TctB (Marinobacter adhaerens HP15)
MTGLGDRILGLGLLVLAVAYGWAAQQWPEPFGGAETVGPETFPTMLAVVLVAGSLYLMIK
PDPDAQWPVGKSAAELGISLVVLVVYTLLLEPLGFVIATTLAVGTLSWRMGAAPRPAFLT
GLLSAVVVFVLFNYGLSLSLPAGLLEVH