Protein Info for Psest_2768 in Pseudomonas stutzeri RCH2

Annotation: Kef-type K+ transport systems, predicted NAD-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 71 to 87 (17 residues), see Phobius details amino acids 96 to 100 (5 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details PF00520: Ion_trans" amino acids 8 to 213 (206 residues), 69.8 bits, see alignment E=2.1e-23 PF07885: Ion_trans_2" amino acids 132 to 208 (77 residues), 62.4 bits, see alignment E=3e-21

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_1607)

Predicted SEED Role

"cAMP-dependent Kef-type K+ transport system" in subsystem Potassium homeostasis or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPM8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Psest_2768 Kef-type K+ transport systems, predicted NAD-binding component (Pseudomonas stutzeri RCH2)
MKQRSVTPFQILILVLSIYVIGALVADLVFDLPDDISTLLGYLDNIVCFFFFLDFWMRLQ
QAENKLRFMRWGWIDLLASVPAGGLQAAKLFRAFQILRVLRAIKSLRLIWRILFRNRAEG
IVASAATATMLLVAFGALTMLLVEAPNPESSINTPEEALWWAFVTVTTVGYGDFYPVTTQ
GRIVAVLLMVSGVGLFGSFAAYIGSLFVADRHEEDNREQLADRETMQRLLLQVECLTEEV
RSLKLQLSDNRREDGDTVERGG