Protein Info for PGA1_c27520 in Phaeobacter inhibens DSM 17395

Annotation: amine oxidoreductase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF01266: DAO" amino acids 12 to 48 (37 residues), 33 bits, see alignment 1.3e-11 PF13450: NAD_binding_8" amino acids 15 to 83 (69 residues), 59.9 bits, see alignment E=6e-20 PF01593: Amino_oxidase" amino acids 20 to 281 (262 residues), 82.1 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: None (inferred from 76% identity to sit:TM1040_0414)

MetaCyc: 57% identical to (E)-11-methyl-12-octadec-12-enoate hydroxylase/cyclase (Cereibacter sphaeroides)
RXN-16881

Predicted SEED Role

"COG2907: Amine oxidase, flavin-containing"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E3T0 at UniProt or InterPro

Protein Sequence (429 amino acids)

>PGA1_c27520 amine oxidoreductase-like protein (Phaeobacter inhibens DSM 17395)
MSFDALSSARERIAVVGGGISGLATAWLLAKTHNVTLFEAAPRLGGHARTVMAGRNGDQP
VDTGFIVFNYVNYPHLTSMFRDLEVPVVKSDMSFGASIGDGRVEYGLRDLGALLGQRRNI
ARPAFFRMVRDILRFNANAEQVAKSDSVTIGELVNDLKLGDWFQRYYLMPICGAIWSTPP
DEIRGFPAQSLVRFFRNHALLSASGQHQWWTVKGGSIEYVRRLTARLEQMGCQLRPGTPV
RSVERTAEGVCIHLPDGTSENFDQVVMACHSDDSLRLLSQPTRAEQATLGVMRYQDNEMI
LHHDSAQMPRRRACWSSWVYKADTRDDRAAIGVTYWMNRLQNIDENDPLFVSLNPVKDVQ
SDLIYDQKTFRHPVFDTAALRAQSQIGDIQGQNNTWFAGAYLRHGFHEDGFASAVRVARG
IDARTRVVG