Protein Info for HP15_2647 in Marinobacter adhaerens HP15

Annotation: peptidoglycan-binding domain 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF20142: Scaffold" amino acids 44 to 180 (137 residues), 119 bits, see alignment E=3.9e-38 PF01471: PG_binding_1" amino acids 208 to 267 (60 residues), 37.1 bits, see alignment 4.4e-13 PF03734: YkuD" amino acids 295 to 463 (169 residues), 82.8 bits, see alignment E=6e-27

Best Hits

KEGG orthology group: None (inferred from 58% identity to maq:Maqu_2894)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJP7 at UniProt or InterPro

Protein Sequence (550 amino acids)

>HP15_2647 peptidoglycan-binding domain 1 protein (Marinobacter adhaerens HP15)
MFALLGTLWHPVCLAADEAIVARIEAMEAGFPVQVLGSRLMAHQALSAFYGANGYQPAWK
SAELRRQLIDSVEQASHDGLNPADYHADILSGLALRPMSDFSEDLRADLDLLFSDAFLML
SSHMLVGKVNPQTVHAEWTANRRQRQMESVLKDALQRSDITGTLDSLRPADPAYRKLMAA
RQDLTRLLGQPWLPLALSPTIRPGDRDERLNEVRRRLSLLGELAESPATFSDPRDYDAEL
ESAVMRFQARHGLEADGLIGKDTLTALNVIPVERLRHIDATLERWRWLPESLGDTYVLVN
IAGFELKMVENGAEVLRKRVIVGQPFRQTPVFSDRIRYLVFNPTWTVPRTLMIQDQLPRI
LRDPNYLSRLNISVYRGWGADRERVDPLEVDWPSLNRNNFPYQLVQEPGPQNALGQIKFM
FPNQYDVYLHDTPGRGLFSRAERSFSSGCIRVEQPFDLAERLLASAPDWSREKIDRVVSE
AQPQTVVLPEPVPVHIQYWTSWVDNEGRLQFRNDLYNRDARLIDQLRGTAEGDTRYNTPV
AGSGPAQDKL