Protein Info for PGA1_c27430 in Phaeobacter inhibens DSM 17395

Annotation: 2-hydroxypropyl-CoM lyase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF01717: Meth_synt_2" amino acids 3 to 65 (63 residues), 22.2 bits, see alignment E=3.9e-09 amino acids 167 to 345 (179 residues), 27.5 bits, see alignment E=9.9e-11

Best Hits

KEGG orthology group: K00549, 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC: 2.1.1.14] (inferred from 83% identity to apb:SAR116_0051)

Predicted SEED Role

"Methionine synthase II (Cobalamin-independent) (EC 2.1.1.14)" (EC 2.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F245 at UniProt or InterPro

Protein Sequence (375 amino acids)

>PGA1_c27430 2-hydroxypropyl-CoM lyase-like protein (Phaeobacter inhibens DSM 17395)
MVKTTHVGSLPRSQDVVDFIFARERQQSFDQADFDACMRAAVSDTVKKQVAAGIDIVSDG
ETSKISYATYVKDRYTGFSGDSPRNAPADLKMFPGFLKRLADDGGTPQYARPMCTGEVRS
KGQGELEKDIANLKSAMAEHGADRGFMNAASPGVISLFLQNDHYPTREAYLAALADAMKT
EYETIVGAGLDLQLDCPDLALSRHMLFTELSDDEFVKVAQMHVEALNHALSDVPAEKVRV
HICWGNYEGPHCCDISMEKVFAPLMATKARYVLFETSNPRHAHEWTVFRDRKAQIPDDKV
LVPGVVDTTTNFVEHPEVVAQRIERFTDILGQDRVIAGSDCGFGTFAGFGAVDPDIAYAK
LSALSEGAKLAAERA