Protein Info for HP15_2645 in Marinobacter adhaerens HP15

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 270 to 290 (21 residues), see Phobius details PF00672: HAMP" amino acids 293 to 342 (50 residues), 23.4 bits, see alignment 6e-09 PF00015: MCPsignal" amino acids 408 to 589 (182 residues), 135.6 bits, see alignment E=1.6e-43

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 44% identity to pmk:MDS_3204)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJP5 at UniProt or InterPro

Protein Sequence (625 amino acids)

>HP15_2645 methyl-accepting chemotaxis protein (Marinobacter adhaerens HP15)
MALSWKQKFLLLIVATLIGLAIATLASLSGLGKVSDAYEARSEARAYESASLTLLNDWLA
LERTSENLEPNQVENYQERLASLAAQSSALSESAGTLPGDAIKTTAQQIQEQVAEYTRLR
TEWLALNQQLGLTPSSGLRATMSEAINDRLRQISISIFNDDINTIASTYRDYLSTFDATY
AESTREALARMQTTVTEMDWQEIDIGQAVQAFANAFSDAESLIANLSAIENQLSATGTRI
RDLIAEQNTLLRQDIIVATSQQAEEARAASTWLIIATAAAVVIILILTLTTASRTLVKRL
NETVNLLTRVAGGDLSQRLEPGRNPNDEFNRLGEAANKMLDDVSDVIGQVVEGNRTLSSL
QVELDALVEQMGRNGEQVEDETEQTATAVQEISHTAVDIAQYTQSVNDAVQSANGAAHSG
AEVVRQSAKTMTELAERIQKTHDQVSQLSKTGEKVNSIVGVINGLAEQTNLLALNAAIEA
ARAGEAGRGFSVVADEVRSLAEKTVSATNGIAEIVESLNRETQAISRLMKEGLTSAGEGE
ESSREAAHSIEQITGSIQQLAGDMNQVVSSVEGISTTTEEIAQKVEQIHGHTRETSDIRQ
KLNAHIGRLSSQVTTLTQASQGFRL