Protein Info for HP15_2644 in Marinobacter adhaerens HP15

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details PF01925: TauE" amino acids 13 to 249 (237 residues), 65.2 bits, see alignment E=3.8e-22

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 63% identity to hel:HELO_1447)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJP4 at UniProt or InterPro

Protein Sequence (258 amino acids)

>HP15_2644 permease (Marinobacter adhaerens HP15)
MSDLAIYQYLLIALIFVWSGFVRSGLGFGGAVLSLPFLLLVLDQPLVFLPIIAVHLLVFS
SLTIWMNNRTGAGKQREAGSGTVDWQYLWRILAIMIVPKLIGVFGLITMPSDILSAIIFV
IVALYSVSYIINRPFRSGSKTVDAIFLMVGGYISGTSLIGAPLIIAVAAQHLPKEKLRDT
LFALWFILVLIKMAAFVWAGIDLQLIHHLWLLPCAAIGHVIGLYAHDRILQAETPVFFRL
LGTVLLLVSSVGIVSVLW