Protein Info for HP15_27 in Marinobacter adhaerens HP15

Annotation: FAD-dependent pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF07992: Pyr_redox_2" amino acids 27 to 324 (298 residues), 233.5 bits, see alignment E=1.5e-72 PF00070: Pyr_redox" amino acids 169 to 246 (78 residues), 50.4 bits, see alignment E=1.1e-16 PF14759: Reductase_C" amino acids 343 to 425 (83 residues), 80.1 bits, see alignment E=5.5e-26

Best Hits

Swiss-Prot: 40% identical to DDMA1_STEMA: Dicamba O-demethylase 1, ferredoxin reductase component (ddmA1) from Stenotrophomonas maltophilia

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 57% identity to gag:Glaag_0387)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI86 at UniProt or InterPro

Protein Sequence (432 amino acids)

>HP15_27 FAD-dependent pyridine nucleotide-disulfide oxidoreductase (Marinobacter adhaerens HP15)
MRAWTEWSYVCPNHNTEPLESKMSLSSVAIVGAGQAGFQVAASLRQGGFKGKISLIGDEP
DLPYQRPPLSKAYMLGKIKRESLAFRPETFFQEQDIDLIHDTAIEIDRQNRRVVLQSGTV
CHYDHLVLATGAHNRPLALPGEDLQGVFGIKTLKDADALSPEVKSARDVVVIGAGFIGLE
FAAIAVQNANVQVIDMGQRAMARAISQEMSEVFEETHQEWGVTFHFNQGVKRLIGSNGKV
TGVEKEDGEILKADLVVYGIGVVPNIAIASEAGLTIENGIKVDSNLLTNDPHISAIGDVA
CFPCTHNEGQFTRIESVPNAMDQARAVAARLLGSPSPFSSVPWFWTDQGNLKLQIAGLST
GFDTTVTLGSKDSRQFSVLCFRKGHFVAVEACNRPGDHLAGKKILSRPPELTPAEANADG
FDLKEWEKQHRD