Protein Info for PGA1_c27400 in Phaeobacter inhibens DSM 17395

Annotation: transcriptional regulator, lacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00356: LacI" amino acids 10 to 52 (43 residues), 47.1 bits, see alignment 3.4e-16 PF00532: Peripla_BP_1" amino acids 65 to 322 (258 residues), 85.6 bits, see alignment E=8.6e-28 PF13407: Peripla_BP_4" amino acids 66 to 311 (246 residues), 84.3 bits, see alignment E=2.1e-27 PF13377: Peripla_BP_3" amino acids 172 to 330 (159 residues), 102.4 bits, see alignment E=6.1e-33

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 68% identity to rde:RD1_3944)

Predicted SEED Role

"Maltose operon transcriptional repressor MalR, LacI family" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZP8 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PGA1_c27400 transcriptional regulator, lacI family (Phaeobacter inhibens DSM 17395)
MTAAKITSADVARLAGVSQSAVSRVFTPGASASKKTVDKVRAAAESLGYRPNSLARAMVS
GRSRIIGLVVAYLENHFYPEALEKLSNALQERGYHVLMFMAPNTAHSIDNVIEEILDYQV
DGIIAASVAMSSELSDRCRAAGVPMVLFNRSQDDPSMSAVTSDNYAGGRKVAEFLLAAGH
RKIGYIAGWEGASTQRDRETGFCERLAEDGLTLHARGVGNFKMETAAEATRQMFTGDRPD
AVFVGNDHMAFAVMDVLRSELGLCVPGDVSVVGYDDVPTAAWPAYDMTTVRQPANRMVSA
TVDILLDEINGAPQRPRRIAIDGPLIVRGSARIPEGWKNEGF