Protein Info for PGA1_c27390 in Phaeobacter inhibens DSM 17395

Annotation: short-chain dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00106: adh_short" amino acids 14 to 206 (193 residues), 184.4 bits, see alignment E=4.4e-58 PF23441: SDR" amino acids 14 to 254 (241 residues), 37.4 bits, see alignment E=4.9e-13 PF01370: Epimerase" amino acids 16 to 178 (163 residues), 26 bits, see alignment E=1.5e-09 PF08659: KR" amino acids 17 to 177 (161 residues), 56.8 bits, see alignment E=7.1e-19 PF13561: adh_short_C2" amino acids 20 to 256 (237 residues), 207.6 bits, see alignment E=5.3e-65

Best Hits

Swiss-Prot: 38% identical to FABG_THEMA: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 68% identity to rhi:NGR_b04430)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTJ4 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_c27390 short-chain dehydrogenase/reductase (Phaeobacter inhibens DSM 17395)
MTLPRTPSFRLDGKRALVTGASSGIGRACAVALAEAGAHVTIAARRIEPLEALVAEMQAA
DMQAEVMVLDVADIAATRASISERITQNGAFDILVNSAGLARHSPASDTTEGDFDAVIDL
NIKGAYFLTQAVAKGLMAAGKPGSLINISSQMAKVGGLDRAVYSATKHAVEGFTKSMAIE
WGKSGIRVNTICPTFIVTPLTQSTFDRPERRAWIESKIQLGRIGEVEDIMGGVVYLASDA
SSLITGTALMIDGGWTAE