Protein Info for Psest_2747 in Pseudomonas stutzeri RCH2

Annotation: Putative NADPH-quinone reductase (modulator of drug activity B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF02525: Flavodoxin_2" amino acids 1 to 215 (215 residues), 184.8 bits, see alignment E=1.6e-58 PF03358: FMN_red" amino acids 1 to 155 (155 residues), 40 bits, see alignment E=3e-14

Best Hits

KEGG orthology group: K00355, NAD(P)H dehydrogenase (quinone) [EC: 1.6.5.2] (inferred from 85% identity to psa:PST_1625)

MetaCyc: 61% identical to roxarsone nitroreductase (Sinorhizobium meliloti)
1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2 or 1.6.99.- or 1.7.1.M3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKH3 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Psest_2747 Putative NADPH-quinone reductase (modulator of drug activity B) (Pseudomonas stutzeri RCH2)
MNVLLVYAHPEPRSLNGALKDFAVQRLQAAGHSVQASDLYAMGWKATIDASDSLDRDPEA
RFDASADSRRAFASGRQSPDIAAEQDKLRWADALILQFPLWWFSMPAILKGWVDRVYAYG
FAYGVGEHSDARWGDRYGEGAMVGKRAMLIVTTGGWDSHYSPRGINGPIDDLLFPIHHGI
LHYPGFDVLPPVVVHRTSRIDPARFDALRNELGERLDGLWRTKPIAYRKQNGGDYDIPAL
MLKADVAPGQVGFAAHIEQP