Protein Info for PGA1_c27340 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 133 to 275 (143 residues), 68.7 bits, see alignment E=2.8e-23

Best Hits

KEGG orthology group: None (inferred from 70% identity to dsh:Dshi_1414)

Predicted SEED Role

"binding-protein-dependent transport systems inner membrane component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTJ1 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PGA1_c27340 ABC transporter, permease protein (Phaeobacter inhibens DSM 17395)
MKHRTFFWFFLPTGLAMLLFIALPIVSVLFQSVHTPHDAVLVTVENCGPFGCKEETTIDQ
EATRALRDAEPLGKFVGLQIYFDRGHLAVAEVAEAWRSTDSIGAFLGEISDLPFYRAMGF
TLTYTFTVTPLLIVLGLMIALAVNSLNRHLKGLVIFFSLLPMIVTPLIGSLILFWMIDSR
GVLGSALQYLTDDPTLSLKASTGLTWVMLIIYGVWHSAPFAFVVFYAGLQTLPQDQLESA
QIDGATRWQRVRYVVVPHLMPLVTFVALIQLMDNFRVFEPIVGFNAEAHATSFSWIIFND
MGGETRLLSSAATTSVLTILGVAVLLTPVLIRTWQDFKGKT