Protein Info for PGA1_c02810 in Phaeobacter inhibens DSM 17395

Annotation: P-hydroxybenzoate hydroxylase PobA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02360: 4-hydroxybenzoate 3-monooxygenase
  • amino acids 21 to 408 (388 residues), 671 bits, E=2.4e-206
• PF01494: FAD_binding_3
  • amino acids 21 to 361 (341 residues), 311.7 bits, E=7.5e-97

Best Hits

Swiss-Prot: 64% identical to PHHY_PSEFL: p-hydroxybenzoate hydroxylase (pobA) from Pseudomonas fluorescens

KEGG orthology group: K00481, p-hydroxybenzoate 3-monooxygenase [EC: 1.14.13.2] (inferred from 71% identity to bra:BRADO2352)

MetaCyc: 64% identical to p-hydroxybenzoate hydroxylase (Pseudomonas fluorescens)
4-hydroxybenzoate 3-monooxygenase. [EC: 1.14.13.2]

Predicted SEED Role

"P-hydroxybenzoate hydroxylase (EC 1.14.13.2)" in subsystem p-Hydroxybenzoate degradation (EC 1.14.13.2)

MetaCyc Pathways

• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-chlorobenzoate degradation (1/4 steps found)
• 4-methylphenol degradation to protocatechuate (1/4 steps found)
• 4-coumarate degradation (aerobic) (1/5 steps found)
• bisphenol A degradation (1/5 steps found)
• 4-hydroxymandelate degradation (1/6 steps found)
• spongiadioxin C biosynthesis (1/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (10/42 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.2

Sequence Analysis Tools

See I7DX43 at UniProt or InterPro

Protein Sequence (408 amino acids)

>PGA1_c02810 P-hydroxybenzoate hydroxylase PobA (Phaeobacter inhibens DSM 17395)
MAKFRHDGRANRRKLMQSQTTQVVIVGGGPSGLLLSQLLHRAGIDTIVLERQTRDYVLGR
IRAGVLEHGFVDLLRRAGASARMDRDGMVHHGFHIAHQGRLDRIDLAGSAKGQTVMVYGQ
TEVTRDLYDARDAMGGQIIHEAANVALHDLTTARPNVTYEQQGETRRIDTKFIVGADGFH
GVSRKSIPSDVLQEYEKVYPFGWLGVLSQTSPAADELIYARHDRGFALCSMRNAQLSRYY
IQVPLTDRVEDWSDAAFWEELKRRLPEDVAKGLQTGVSIEKSIAPLRSFVAEPMRYGALF
LAGDAAHIVPPTGAKGLNLAASDIHYLYEGLSDHFQRNDDTALDSYSERALARIWKAERF
SWWMTNLLHRFPDMSPADLRLQQADLDYLFSSDAAQASLAENYVGLPY