Protein Info for Psest_2737 in Pseudomonas stutzeri RCH2

Annotation: Restriction endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details PF04471: Mrr_cat" amino acids 105 to 216 (112 residues), 109.7 bits, see alignment E=1.4e-35 PF22722: NA-iREase1" amino acids 119 to 212 (94 residues), 28.8 bits, see alignment E=1.6e-10 PF01396: Zn_ribbon_Top1" amino acids 257 to 294 (38 residues), 40.2 bits, see alignment 3.4e-14

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_1633)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKG5 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Psest_2737 Restriction endonuclease (Pseudomonas stutzeri RCH2)
MARRRKQSPFEDLIDLAALMPWWITLPLALIAYLWLNSIVTSPIPAPANPADLGSHMSGM
MLRGLAVPAQYFVPAALVFGAIASAFGRMRRKKLFDSVASNENTLESISWREFELLVGEA
FRRKGFTVQETGQGGADGGIDLVLLKDGEKYLVQCKQWRRQLVQVNVIRELFGVMTAEGA
KGGFVVISGRFTEDAKVFAQGKNLQLIEGAELNEMIRQSRATATRQKAQPTTSKAPYQPT
PATSDPLVETPCATQPICPTCQAPMVQRVAKRGSNAGNTFWGCSQYPKCKTTRNEIPA